DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG3191

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:290 Identity:59/290 - (20%)
Similarity:116/290 - (40%) Gaps:33/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRSSSSKRQVATTDGDPERVLAQVQDLS---DWLVANPQINGCNTFENLHFFLRTSKFDVERAKK 64
            |.:|...::...:|...:.|..|.:||.   :|...|.::........|..|.:....|||..:|
  Fly    12 SGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRK 76

  Fly    65 KLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLP---IGPDAEQRMVVVIRTAAHDPKLHSQ 126
            .::..|.:|......|..|||...:.:........||   :.||..:..:...|........|::
  Fly    77 LIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTE 141

  Fly   127 NN--VFKTSK---MILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVE-SWTAYP 185
            :.  .|..|.   :..|.|.|  |:..:.|.|.|.||:|..:.|..::....::..:: ...|:|
  Fly   142 DTRAFFMVSDCRFVTPDDLAK--PDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFP 204

  Fly   186 CQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRL------------FVRREGTSVSCDQLPKELG 238
            .:.:.:...|.|.:::..::..:.|::.::...:            ||.||       .||:|.|
  Fly   205 VRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPRE-------MLPEEYG 262

  Fly   239 GQGLSYMELSVKWKQLVEENADFYVEQDKY 268
            |...|...|....::.:.|:.|:.::.|.:
  Fly   263 GGAGSLEALRTHTQKALVEHRDYLMDPDHW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 32/173 (18%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 29/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.