DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Ttpal

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:115/260 - (44%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PERVLAQVQDLSDWLVAN-PQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDN 82
            ||..|..||.|.|.:... |.::.......|..|||..|||.:||.:.|..::..|....|.|.|
  Rat    52 PEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSN 116

  Fly    83 RDPQLPEIQDLLKLGVFLPIGPDAEQR--MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDP 145
            ..|.  .::|:|..| ||.:.|..:.|  .|:.||.....|..:......:...:.|:.|::.: 
  Rat   117 LRPS--ALKDVLNSG-FLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAIYLTLEKLIQSE- 177

  Fly   146 ETCARGMVAILDMQGVQLGHALQMNPKLIKRSVE-SWTAYPCQPKLLEFTNAPRHVNFFLNTFRI 209
            ||...|:|.:.|.:||.|..|....|.:.::.:. ....:|.:.|.:...|.||   .|...|.|
  Rat   178 ETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPIRIKAVHIVNEPR---IFKGIFAI 239

  Fly   210 ---FMTPKIRSRLFVRREG-----TSVSCDQLPKELGGQGLSYMEL-SVKWKQLVEENADFYVEQ 265
               |:..||.:|.|:....     ||:..:.||||.||   :..|| :..|..::..:.|.:|::
  Rat   240 IKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGG---TAGELDTASWNAVLLASEDDFVKE 301

  Fly   266  265
              Rat   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 43/163 (26%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 15/45 (33%)
SEC14 122..278 CDD:238099 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.