DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Rlbp1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:201 Identity:47/201 - (23%)
Similarity:89/201 - (44%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGP------DAEQR 109
            |:|..||||.||.:.||.:...|.:..|.||:.  .:..::..::.|.     |      |...|
  Rat    99 FIRARKFDVGRAYELLKGYVNFRLQYPELFDSL--SMEALRCTIEAGY-----PGVLSSRDKYGR 156

  Fly   110 MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLI 174
            :|::........:..:.:.:.:....||:.||: :.||...|...:.:.:|..:..|..:.|..:
  Rat   157 VVMLFNIENWHCEEVTFDEILQAYCFILEKLLE-NEETQINGFCIVENFKGFTMQQAAGLRPSDL 220

  Fly   175 KRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVR---REGTSVSCDQ--L 233
            |:.|:. ..::|.:.|.:.|.:.|.:.....|..:.|:..|:..|:||.   .:|.....|:  |
  Rat   221 KKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENIL 285

  Fly   234 PKELGG 239
            |.:.||
  Rat   286 PADFGG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 33/165 (20%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 10/17 (59%)
CRAL_TRIO 143..292 CDD:279044 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.