DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Ttpa

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:261 Identity:69/261 - (26%)
Similarity:121/261 - (46%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RQVATTDGDPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRA 74
            |:.|..:|.||    ..|.|:|..:..              |||...||::.|.:.:|.:|:.||
  Rat    32 RRRAQEEGVPE----TPQPLTDAFLLR--------------FLRARDFDLDLAWRLMKNYYKWRA 78

  Fly    75 ERTEWFDNRDPQLPEIQDLLKL---GVFLPIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMI 136
            |..|...:..|:  .|..|||.   ||.....|...:  |::.|.:..|||:.:..:||:.|.:.
  Rat    79 ECPELSADLHPR--SILGLLKAGYHGVLRSRDPTGSR--VLIYRISYWDPKVFTAYDVFRVSLIT 139

  Fly   137 LDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESWT-AYPCQPKLLEFTNAPRHV 200
            .:|::: :.||...|:.||.|::|.|:.||.|:.|.:.|:.....| ::|.:.:.:...|.|...
  Rat   140 SELIVQ-EVETQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIF 203

  Fly   201 NFFLNTFRIFMTPKIRSRLFVRREGTSVSC-----DQLPKELGGQGLSYMELSVKWKQLVEENAD 260
            :...:..:.|:|.||:.|:.:.......|.     |.||.|.||...|..::..:|...:.::.|
  Rat   204 HAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFPDILPLEYGGNESSMEDICQEWTNFIMKSED 268

  Fly   261 F 261
            :
  Rat   269 Y 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 44/161 (27%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 15/58 (26%)
CRAL_TRIO 99..248 CDD:395525 40/151 (26%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.