DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and SEC14L2

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens


Alignment Length:263 Identity:60/263 - (22%)
Similarity:106/263 - (40%) Gaps:68/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAER-----TEWFDNRDPQLPE-IQDLLKLGV----------- 98
            :||...||:::::..|:...:.|.::     ..|      |.|| ||..|..|:           
Human    41 WLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISW------QPPEVIQQYLSGGMCGYDLDGCPVW 99

  Fly    99 FLPIGP-DAEQRMVV-----VIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILD 157
            :..||| ||:..:..     ::||...:.:|..|....:|:|      |....||    :..|.|
Human   100 YDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTK------LGRKVET----ITIIYD 154

  Fly   158 MQGVQLGHALQMNPKLIKRSVESWTAYPCQ-----PKLLE---FTNAPRHVNFFLNTFRIFMTPK 214
            .:|:.|.|       |.|.:||::..:.|.     |:.|:   ...||:......|..:.|::..
Human   155 CEGLGLKH-------LWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSED 212

  Fly   215 IRSRLFVRREGTS--------VSCDQLPKELGGQGLSYMELSVKWKQLVEENADF---YVEQDKY 268
            .|.::.|.  |.:        :|.||:|.|.||. ::..:.:.|.|..:....|.   |..:|:.
Human   213 TRKKIMVL--GANWKEVLLKHISPDQVPVEYGGT-MTDPDGNPKCKSKINYGGDIPRKYYVRDQV 274

  Fly   269 KSK 271
            |.:
Human   275 KQQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 45/186 (24%)
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 5/17 (29%)
SEC14 76..244 CDD:214706 45/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.