DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Clvs2

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:121/271 - (44%) Gaps:22/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHF-FLRTSKFDVERAKKKLKTFYQMRAERTEWFD 81
            :|:.:...:|::.|.::..|.|....|.:.... |||..||....|.:.|..:::.|.:..:.|.
Mouse    23 NPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFK 87

  Fly    82 NRDPQLPEIQDLLKLGVFLPIG---PDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKL 143
            :.....|.|:..||.|  .|.|   .|...|.::|:..|..|...::..::.:...:.|:.::: 
Mouse    88 SFKATDPGIKQALKDG--FPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIE- 149

  Fly   144 DPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTF 207
            |||....|.|.|:|........|.::.|.:::.::|. ..::|.:...:.|.|.|.:::......
Mouse   150 DPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVI 214

  Fly   208 RIFMTPKIRSRLFVRREGTS-----VSCDQLPKELGGQGLSYMELSVKWKQLV-----EENADFY 262
            |.|:..|.|.|:|:.....:     :..:.||.|.||. |...::.. |.:.:     ::::::.
Mouse   215 RPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGM-LPPYDMGT-WARTLLDHEYDDDSEYN 277

  Fly   263 VEQDKYKSKLK 273
            |  |.|...:|
Mouse   278 V--DSYNMPVK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 37/161 (23%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 30/145 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.