DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and F28H7.8

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_505746.2 Gene:F28H7.8 / 185099 WormBaseID:WBGene00009241 Length:410 Species:Caenorhabditis elegans


Alignment Length:287 Identity:61/287 - (21%)
Similarity:99/287 - (34%) Gaps:111/287 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGDPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWF 80
            |...|:|..||.|:.|     |:.   :|..|:..:|:::.|::.:....||       :..:|.
 Worm    16 DAAIEQVRLQVSDVID-----PRY---DTKWNMLRWLQSNDFNIPKTVHLLK-------KHLKWR 65

  Fly    81 DNRDPQLPEIQDLLKLG----VFLP---IGPDAEQ---RMVVVIRTAAHDPK-----------LH 124
            .:|....||.|.||:..    ...|   |||..::   |:|||.|....|..           ||
 Worm    66 KDRKLDEPESQSLLQFSDARRKHAPIDIIGPQRKEDGDRLVVVDRAGRIDVSGLMKSVQPTEYLH 130

  Fly   125 SQNNVFKTSKMILDLLLKLDPET---CARGMVAILDMQGVQLGHALQMNPKLIKRSVESWTAYPC 186
               .:|::.:.|...|:|::.||   |.  |..|.|::.:..                       
 Worm   131 ---EMFRSFEEIQRRLMKMEAETGVQCY--MHYIFDLEALNF----------------------- 167

  Fly   187 QPKLLEFTNAP---------RHVNFFLNTFRIFMTPKIRSRLFVRREGTSVSCDQLPKELGGQGL 242
            .|.||...|.|         :|...|::.|.:..:|                             
 Worm   168 DPTLLGVVNGPFRVSWQLVGQHYREFIDKFIVINSP----------------------------- 203

  Fly   243 SYMELSVKWKQLVEENADFYVEQDKYK 269
            ||  ::|.|..|    :.|..||.|.:
 Worm   204 SY--INVLWSAL----SPFIPEQSKQR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 36/185 (19%)
F28H7.8NP_505746.2 CRAL_TRIO_N 16..61 CDD:215024 14/59 (24%)
SEC14 93..251 CDD:214706 39/195 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.