DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and cgr-1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:109 Identity:22/109 - (20%)
Similarity:46/109 - (42%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MRAERTEWFD--NRDPQLPEIQDLLKLGVFLPIGPDAEQRM--VVVIRTAAHDPKLHSQNNV--- 129
            |..::|...|  |||     |:::..:..:.|.|...:.:.  ||.::..|   |.|.:..|   
 Worm    74 MNNKQTTSVDQINRD-----IKNMSAVAEYFPGGIMGKSKRGDVVYMQAMA---KAHPKTLVKAG 130

  Fly   130 ---------FKTSKMILDLLLKLDPETCAR-GMVAILDMQGVQL 163
                     ...::|...::.:.:.||..: |::.|:|:.|..:
 Worm   131 PTSQLFQLCISETEMSFKIIRQTEQETERKMGVIIIMDLDGFSM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 16/92 (17%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.