DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and C34C12.6

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:296 Identity:62/296 - (20%)
Similarity:109/296 - (36%) Gaps:74/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGDPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWF 80
            ||.|:.|             |..:|.|......|       .|.|:..|...|:  :.:.:...|
 Worm    34 DGIPDDV-------------NTDLNLCRWIRGYH-------GDTEKLVKNFATY--LASRKAAGF 76

  Fly    81 DNRD-----PQLPEIQDLLKLGVFLPIGP------DAEQRMVVVIRTAAHDPK------------ 122
            ...|     .:||.|...|:   |:....      ..|....:.:..|...||            
 Worm    77 VGNDFAEKFFELPSIAPFLQ---FIASSRLQDRQWSDEHNAFLFVERAWSQPKEFIKTFKTSDYL 138

  Fly   123 LHSQNNVFKTSKMILDLLLKLDPETCA-RG---MVAILDMQGVQLGHALQMNP-----KLIKRSV 178
            ||    .|..|:|:..|:|:.:.:..| :|   .:.|.|:..|.:..  .:||     ||.:...
 Worm   139 LH----CFGYSEMLQQLILRREKKQSADKGPVQFIVIFDLNTVNITD--YVNPMSGYMKLWQIRS 197

  Fly   179 ESWTA-YPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTSVSCDQL-----PKEL 237
            |.|.. :|...:.:..||.||.:.......|:|::.:...|:.:..:.:.::...|     |||.
 Worm   198 ELWQDWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPWLVPKEY 262

  Fly   238 GGQGLSYM----ELSVKWKQLVEENADFYVEQDKYK 269
            ||:.::.:    |..|..::.: .:||:|.....||
 Worm   263 GGEFVNTVPPGDETGVSVRRKI-TSADYYKPYQHYK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 40/185 (22%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 38/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.