DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and ctg-2

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:231 Identity:44/231 - (19%)
Similarity:79/231 - (34%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGV----------FLP---IGPDAE 107
            |.||...|.|    :.:||......|..|     :..|.|:..          :||   ||.|.|
 Worm    61 KIDVVVPKIK----FSLRAIHALGLDQED-----LSTLEKVAQKCDDCSVPLRYLPGSLIGLDHE 116

  Fly   108 QRMVVV----------IRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPET-CARGMVAILDMQGV 161
            ..:|.:          :..|..:..|:...  ...|:.::.::.|::.|. ...|...|.|:.|:
 Worm   117 NNVVSLQMIGHLDAAGLMPATRNSDLYRMR--IAESEGVMQIIRKMEKEQGKPLGTSVIFDLDGL 179

  Fly   162 QLGH----ALQMNPKLIKRSVESWTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVR 222
            .:..    ||::...::.:..|   .:|...:.:...|.|.    |:......::|.:..:    
 Worm   180 SMVQIDLAALKVVTTMLSQLQE---MFPDVIRKIFIVNTPT----FIQVLWSMISPCLAKQ---- 233

  Fly   223 REGTSVSCDQLPKELGGQGLSYMELSVKWKQLVEEN 258
                   ..|..|.||..          |||.::||
 Worm   234 -------TQQKVKILGND----------WKQHLKEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 30/180 (17%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 33/185 (18%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.