DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Sec14l2

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:295 Identity:73/295 - (24%)
Similarity:120/295 - (40%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ERVLAQV-QDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAER-----TE 78
            |..||:. :::.|.|.|.|  |..:.|  |..:||...||:::::..|:...:.|.::     ..
  Rat    13 EEALAKFRENVQDVLPALP--NPDDYF--LLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIIS 73

  Fly    79 WFDNRDPQLPE-IQDLL---KLGVFLP--------IGP-DAEQRMVV-----VIRTAAHDPKLHS 125
            |      |.|| ||..|   :.|..|.        ||| ||:..:..     ::||...|.:|..
  Rat    74 W------QPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLL 132

  Fly   126 QNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESW--------T 182
            |....:|:|:...:      ||    :..|.|.:|:.|.|       |.|.:||::        .
  Rat   133 QECTHQTAKLGKKI------ET----ITMIYDCEGLGLKH-------LWKPAVEAYGEFLTMFEE 180

  Fly   183 AYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTS--------VSCDQLPKELGG 239
            .||...|.|....||:......|..:.|::...|.::.|.  |.:        :|.||||.|.||
  Rat   181 NYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVL--GANWKEVLLKHISPDQLPVEYGG 243

  Fly   240 QGLSYMELSVKWKQLVEENADF---YVEQDKYKSK 271
            . ::..:.:.|.|..:....|.   |..:|:.|.:
  Rat   244 T-MTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 48/186 (26%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 15/49 (31%)
SEC14 76..244 CDD:214706 48/186 (26%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.