DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Sec14l4

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:281 Identity:58/281 - (20%)
Similarity:100/281 - (35%) Gaps:93/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QVATTDGDPERVLAQVQD-LSDWLVANPQINGCNTFENLHF---FLRTSKFDVERAKKKLKTFYQ 71
            ||.......:..||:.:: |.|.|...|:.:.       :|   :||...||:::::..|:...:
Mouse     4 QVGDLSPQQQEALARFRETLQDLLPTLPKADD-------YFLLRWLRARNFDLKKSEDMLRKHVE 61

  Fly    72 MRAERT------------------------------EWFD---NRDPQLPEIQDLLKLGVFLPIG 103
            .|.::.                              .|||   ..||:          |:|:...
Mouse    62 FRNQQNLDQILTWQAPEVIQLYDSGGLSGYDYEGCPVWFDIIGTMDPK----------GLFMSAS 116

  Fly   104 -PDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHAL 167
             .|..::.:.|.....|:.:|.||....|..:|::                 :.||:|:.|.|  
Mouse   117 KQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVM-----------------VFDMEGLSLRH-- 162

  Fly   168 QMNPKLIKRSVESW--------TAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFV--- 221
                 |.|.:||.:        ..||...|.|....||:......|..:.||..:.:.::.:   
Mouse   163 -----LWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGG 222

  Fly   222 --RREGTS-VSCDQLPKELGG 239
              ::|... ||.||||.|.||
Mouse   223 NWKQELVKFVSPDQLPVEFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 38/168 (23%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 12/52 (23%)
SEC14 77..244 CDD:214706 43/201 (21%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.