DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and clvs1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_012819596.1 Gene:clvs1 / 100037913 XenbaseID:XB-GENE-5740434 Length:332 Species:Xenopus tropicalis


Alignment Length:231 Identity:52/231 - (22%)
Similarity:102/231 - (44%) Gaps:11/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHF-FLRTSKFDVERAKKKLKTFYQMRAERTEWFD 81
            :|:.:...:|.:.|.::..|.|....|.:.... |||..||:...|.:.|..::|.|....:.|.
 Frog    23 NPDTLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFK 87

  Fly    82 NRDPQLPEIQDLLKLGVFLPI--GPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLD 144
            |.....|.|:..|..| |..:  ..|...|.::::..|..|...:|..::.:...:.|::|:: |
 Frog    88 NLKADDPGIKRALMDG-FPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIE-D 150

  Fly   145 PETCARGMVAILDMQGVQLGHALQMNPKLIKRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTFR 208
            .|....|.:.|:|........|.::.|.:::.::|. ..::|.:...:.|.|.|.:::......:
 Frog   151 QELQINGFILIIDWSNFSFKQASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIK 215

  Fly   209 IFMTPKIRSRLFVRREGTS-----VSCDQLPKELGG 239
            .|:..|.|.|:|:.....:     :..|.||.|.||
 Frog   216 PFLKDKTRKRIFLHGNNLNSLHQLIHPDCLPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 35/161 (22%)
clvs1XP_012819596.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..252 CDD:238099 30/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.