DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and MOB2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_116618.1 Gene:MOB2 / 850508 SGDID:S000001859 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:74/183 - (40%)
Similarity:114/183 - (62%) Gaps:6/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADG 100
            |..|:.:..|.||...||.||:|:|..:||..:|..||.:.|:.|.:....|:|||..:|.|.| 
Yeast   105 LVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTDYLWLD- 168

  Fly   101 LTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQ 165
             ...:.:...|.:|||..:||:.::::|:.|||:|.|:|||:.|....:.|:.::||::|||||.
Yeast   169 -ANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHH 232

  Fly   166 HFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQ 218
            ||.::|.|..|||.|:.|.|||.|.:||.:|:|:|:|||..||:..    |:|
Yeast   233 HFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESF----EKQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 68/167 (41%)
MOB2NP_116618.1 Mob1_phocein 102..271 CDD:397617 68/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.