DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and MOB2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001165694.1 Gene:MOB2 / 81532 HGNCID:24904 Length:268 Species:Homo sapiens


Alignment Length:208 Identity:90/208 - (43%)
Similarity:121/208 - (58%) Gaps:10/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSSKTFKP--KKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINM 70
            |.||. ||  ||...|....|...:|..|.:.....:..|.||...|||||:|.||..||:.||:
Human    37 RKSKA-KPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINL 100

  Fly    71 LYGTITEFCTEETCGIMSAGPKYEYHWAD--GLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFP 133
            .|.||:||||.|||..| |....:|:|.|  |    |.:||:||:|:|::|:.||..:.||.:||
Human   101 QYSTISEFCTGETCQTM-AVCNTQYYWYDERG----KKVKCTAPQYVDFVMSSVQKLVTDEDVFP 160

  Fly   134 SKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIER 198
            :|.|..||.:|.|..:.|.:.||.|.||||..||.|.:.|....||||.:.|||.|.:||||::.
Human   161 TKYGREFPSSFESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDP 225

  Fly   199 RELAPLQELIDKL 211
            :|.|.:.:|.:.|
Human   226 KETAIMDDLTEVL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 78/171 (46%)
MOB2NP_001165694.1 Mob1_phocein 63..231 CDD:281617 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.