DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob2b

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005173750.1 Gene:mob2b / 724012 ZFINID:ZDB-GENE-060616-319 Length:245 Species:Danio rerio


Alignment Length:203 Identity:86/203 - (42%)
Similarity:116/203 - (57%) Gaps:11/203 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KPKKNIP---EGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTI 75
            ||....|   |..|..| .::....:....|:..|.||...|||||:|.||..|||.||:.|.||
Zfish    36 KPNGKKPPTEEKKHYLD-AEYTKVRVVDFELKELVVLPREIDLNEWLASNTTTFFNLINLQYSTI 99

  Fly    76 TEFCTEETCGIMSAGPKYE--YHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGV 138
            :||||.:||..|||   |.  |.|.|  ...|..||:||:|:|::|:.||..:.||.:||:|.|.
Zfish   100 SEFCTGDTCPAMSA---YSTTYFWYD--EKGKKTKCTAPQYVDFVMSSVQKLVTDEDIFPTKYGK 159

  Fly   139 PFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAP 203
            .||..|.|..|.|.:.||.|.||||..|:.|.|.:....||||.:.|||.|::||||::.:|.:.
Zfish   160 EFPNTFDSLVKKICRYLFHVLAHIYWSHYKETVAMDLHGHLNTLYTHFIVFIREFNLMDPKETSI 224

  Fly   204 LQELIDKL 211
            :.:|.:.|
Zfish   225 MDDLTEAL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 78/171 (46%)
mob2bXP_005173750.1 Mob1_phocein 59..225 CDD:281617 78/170 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.