DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and MOB1A

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001304040.1 Gene:MOB1A / 55233 HGNCID:16015 Length:258 Species:Homo sapiens


Alignment Length:209 Identity:182/209 - (87%)
Similarity:195/209 - (93%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINML 71
            ||||||||||||||||:|||:|:|||.|||||||||.||.||:|||||||:||||||||||||||
Human    49 SRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINML 113

  Fly    72 YGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKI 136
            ||||||||||.:|.:|||||:||||||||..:|||||||||||||||||||||||||||||||||
Human   114 YGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKI 178

  Fly   137 GVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERREL 201
            ||||||||.|.||||||||||||||||||||..|:.|.||||||||||||||||||||||:||||
Human   179 GVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRREL 243

  Fly   202 APLQELIDKLTAKD 215
            |||||||:||.:||
Human   244 APLQELIEKLGSKD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 149/169 (88%)
MOB1ANP_001304040.1 Mob1_phocein 75..246 CDD:397617 149/170 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147132
Domainoid 1 1.000 324 1.000 Domainoid score I1203
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 402 1.000 Inparanoid score I1925
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54186
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 1 1.000 - - otm41298
orthoMCL 1 0.900 - - OOG6_101569
Panther 1 1.100 - - LDO PTHR22599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R729
SonicParanoid 1 1.000 - - X263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.