DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and Mob2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_038943799.1 Gene:Mob2 / 499288 RGDID:1562983 Length:266 Species:Rattus norvegicus


Alignment Length:208 Identity:90/208 - (43%)
Similarity:120/208 - (57%) Gaps:10/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSSKTFKP--KKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINM 70
            |.||. ||  ||...|....|...:|..:.:.....:..|.||...|||||:|.||..||:.||:
  Rat    37 RKSKA-KPNGKKPAAEEKKVYLEPEHTKSRITDFEFKELVVLPREIDLNEWLASNTTTFFHHINL 100

  Fly    71 LYGTITEFCTEETCGIMSAGPKYEYHWAD--GLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFP 133
            .|.||:||||.|||..| |....:|:|.|  |    |.:||:||:|:|::|:.||..:.||.:||
  Rat   101 QYSTISEFCTGETCQTM-AVCNTQYYWYDERG----KKVKCTAPQYVDFVMSSVQKLVTDEDVFP 160

  Fly   134 SKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIER 198
            :|.|..||.:|.|..|.|.|.||.|..|||..||.|.:.|....||||.:.|||.|.:||||::.
  Rat   161 TKYGREFPSSFESLVKKICKYLFHVLGHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDP 225

  Fly   199 RELAPLQELIDKL 211
            :|.|.:.:|.:.|
  Rat   226 KETAVMDDLTEVL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 78/171 (46%)
Mob2XP_038943799.1 Mob1_phocein 63..231 CDD:397617 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.