DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob2.2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001008166.1 Gene:mob2.2 / 493528 XenbaseID:XB-GENE-5751803 Length:234 Species:Xenopus tropicalis


Alignment Length:204 Identity:74/204 - (36%)
Similarity:108/204 - (52%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLY 72
            |..|..:|:|...|       .::.||.:...::...||||.|.::.||:|.|...|:|.:::.|
 Frog    24 REKKGIEPEKIYLE-------PRYTAARIVDADILMLVALPKGLNVEEWLASNASAFYNHVSLFY 81

  Fly    73 GTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIG 137
            |.|:||||..:|..|.|. ..:|.|.|....||  |||||:|.||..:.:|..|.||.|.|:|..
 Frog    82 GAISEFCTISSCPTMKAW-SIQYQWTDEKGRKK--KCSAPQYADYAASIIQKILTDEDLVPTKHC 143

  Fly   138 VPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELA 202
            ..|||.|..|.:...:.||.:..|||..|:..||.|....||||.:.|.:.|..||.|::.:|::
 Frog   144 KEFPKTFRPSIQKTFRLLFHLLGHIYTSHYKTVVNLELHPHLNTLYLHLLLFCAEFQLLDSKEMS 208

  Fly   203 PLQELIDKL 211
            ..::|...|
 Frog   209 LSEDLTTAL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 66/169 (39%)
mob2.2NP_001008166.1 Mob1_phocein 43..208 CDD:367587 66/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.