DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob2a

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005170738.1 Gene:mob2a / 436637 ZFINID:ZDB-GENE-040718-56 Length:230 Species:Danio rerio


Alignment Length:216 Identity:98/216 - (45%)
Similarity:131/216 - (60%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FGSRSSKTFKP--KKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGE-DLNEWVAVNTVDFFN 66
            |..|.||| ||  ||..||....|...::....:...:|::.||||..| |||||:|.||..|||
Zfish    10 FFYRKSKT-KPNGKKAPPEEKKHYLEPEYTKVRVADFDLKDLVALPTKEIDLNEWLASNTTTFFN 73

  Fly    67 QINMLYGTITEFCTEETCGIMSAGPKYE--YHWAD--GLTVKKPIKCSAPKYIDYLMTWVQDQLD 127
            .||:.|.||:||||.:||..|:|   |.  |:|.|  |    |..||:||:|:|.:||:||..:.
Zfish    74 LINLQYSTISEFCTGDTCQAMTA---YNTIYYWYDERG----KKTKCTAPQYVDLVMTFVQKLVT 131

  Fly   128 DETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQE 192
            ||.:||:|.|..||.:|.|..|.:.:.||.|.||||..||.|:|.|..:.||||.:.|||.|::|
Zfish   132 DEEIFPTKYGKDFPNSFESLVKKVCRYLFHVLAHIYWAHFKEIVALDLQGHLNTLYAHFIVFIRE 196

  Fly   193 FNLIERRELAPLQELIDKLTA 213
            ||||:.:|...:.:|.:.|.|
Zfish   197 FNLIDPKETCIMDDLSEVLCA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 83/174 (48%)
mob2aXP_005170738.1 Mob1_phocein 46..205 CDD:281617 82/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.