DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob2.1

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_012816180.1 Gene:mob2.1 / 394609 XenbaseID:XB-GENE-956898 Length:260 Species:Xenopus tropicalis


Alignment Length:215 Identity:91/215 - (42%)
Similarity:126/215 - (58%) Gaps:10/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSSKTFKP--KKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINM 70
            |.||. ||  ||...|....|...::....:.....:..|.||...|||||:|.|...|||.||:
 Frog    37 RKSKG-KPNGKKPASEEKKLYLEPEYTRVRVTDVEFKQLVTLPQEIDLNEWLASNVTTFFNHINL 100

  Fly    71 LYGTITEFCTEETCGIMSAGPKYEYHWAD--GLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFP 133
            .|.||:||||.|||..|:| ...:|:|.|  |    |.:||:||:|||::|:.||..:.||.:||
 Frog   101 QYSTISEFCTGETCQTMAA-CNTQYYWYDERG----KKLKCTAPQYIDFVMSSVQKLVTDEDVFP 160

  Fly   134 SKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIER 198
            :|.|..||.:|.|..|.|.:.||.|.||||..||.|:..|....||||.|.||:.||:||:|::.
 Frog   161 TKYGREFPSSFESLIKKICRYLFHVLAHIYSAHFKEITALELHGHLNTLFIHFLLFVREFSLLDP 225

  Fly   199 RELAPLQELIDKLTAKDERQ 218
            :|.:.|.:|.:.|.:::.|:
 Frog   226 KETSILDDLSEVLFSEENRE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 78/171 (46%)
mob2.1XP_012816180.1 Mob1_phocein 65..231 CDD:367587 78/170 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.