DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and Mob4

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster


Alignment Length:164 Identity:37/164 - (22%)
Similarity:73/164 - (44%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVK 104
            |:...:.:|:.:|...|...:...|..::|.|...:.:.|:..||..|:|..::.:..|   ..|
  Fly    53 NVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCA---AHK 114

  Fly   105 KPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIG--VPFPKNFHSSAKTILKRLFRVYAHIYHQHF 167
            .|.:|.|..|..:.:......|:....|||.:.  |...::..:...::.:|::|:::|.|..|.
  Fly   115 TPKECPAIDYTRHTLDGAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHR 179

  Fly   168 TEVVTLGEEAHLNTSFKHFIFFVQEFNLIERREL 201
            ........|.:|...|.|   ||.::||:.:..|
  Fly   180 RIFDEFEAETYLCHRFTH---FVTKYNLMSKENL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 37/164 (23%)
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.