DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and Mob3c

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001101430.1 Gene:Mob3c / 313511 RGDID:1307821 Length:234 Species:Rattus norvegicus


Alignment Length:195 Identity:97/195 - (49%)
Similarity:144/195 - (73%) Gaps:1/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTFKPKKNIPEGTHQYDLMKHAAATLGSG-NLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGT 74
            |||:|:|....||.:::|.|.|.|:|.|| :||..|.||.||.:::|:||:.|||||:||::|||
  Rat    13 KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRRVVRLPPGESIDDWIAVHVVDFFNRINLIYGT 77

  Fly    75 ITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVP 139
            :.|.|:|.:|.:|:.||:|||.|.|....::|.|.|||:|:..||.|::..::||.:||:::|||
  Rat    78 MAEHCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEDVFPTRVGVP 142

  Fly   140 FPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPL 204
            |||||......||.|||||:.|:|..||..::::|.|||:||.:|||.:|:|||:|:::|||.||
  Rat   143 FPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIQEFSLVDQRELEPL 207

  Fly   205  204
              Rat   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 85/170 (50%)
Mob3cNP_001101430.1 Mob1_phocein 35..207 CDD:397617 85/171 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54186
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.