DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_587851.1 Gene:mob2 / 2539016 PomBaseID:SPCC970.04c Length:244 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:82/206 - (39%)
Similarity:125/206 - (60%) Gaps:4/206 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FGSRSSKTFKPKKNIP--EGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQ 67
            |..:||.:...:...|  |.|..|.........|..||....|:||...||:||||:|..:.|..
pombe    32 FSKKSSTSQLVRTGSPSVEPTALYLQQPFVRTHLVKGNFSTIVSLPRFVDLDEWVALNVYELFTY 96

  Fly    68 INMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLF 132
            :|..|.....|||.:||.:|||...::|.|.|  ..:||:...||:||:|::.|::::|.|:.:|
pombe    97 LNHFYDVFATFCTVKTCPVMSAAANFDYTWLD--NNRKPVHLPAPQYIEYVLAWIENRLHDQNVF 159

  Fly   133 PSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIE 197
            |:|.|:|||.||....|.|.|::||::||:|:.|:.|::.|..|||.|:.|.|||.|.:||.|::
pombe   160 PTKAGLPFPSNFLVIVKAIYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLD 224

  Fly   198 RRELAPLQELI 208
            :|:.|||::||
pombe   225 KRDTAPLKDLI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 71/169 (42%)
mob2NP_587851.1 Mob1_phocein 65..231 CDD:281617 71/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.