DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and Mob3b

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_835162.1 Gene:Mob3b / 214944 MGIID:2664539 Length:216 Species:Mus musculus


Alignment Length:202 Identity:112/202 - (55%)
Similarity:150/202 - (74%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTFKPKKNIPEGTHQYDLMKHAAATLGSG-NLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGT 74
            |||:||:....||.:::|.|.|.|:|.|| :||.||.||:|||.|:||||:.|||||:||::|||
Mouse    13 KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLRAAVQLPNGEDQNDWVAVHVVDFFNRINLIYGT 77

  Fly    75 ITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVP 139
            |.|||||.||.:||.||||||.|.|.|..|||....||:|::.||.|::.|:::|.:||:.:|||
Mouse    78 ICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEDIFPTCVGVP 142

  Fly   140 FPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPL 204
            |||||....|.||.|||||:.|:|..||..|:.:|.|||:||.:|||.:||.|.|||:|:||.||
Mouse   143 FPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPL 207

  Fly   205 QELIDKL 211
            :|:..::
Mouse   208 KEMTTRM 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 99/170 (58%)
Mob3bNP_835162.1 Mob1_phocein 35..207 CDD:397617 99/171 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54186
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R729
SonicParanoid 1 1.000 - - X263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.