DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and Mob3a

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_766045.2 Gene:Mob3a / 208228 MGIID:3050117 Length:217 Species:Mus musculus


Alignment Length:202 Identity:105/202 - (51%)
Similarity:149/202 - (73%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTFKPKKNIPEGTHQYDLMKHAAATLGSG-NLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGT 74
            |||:||:....||.:::|.|.|.|:|.:| :||.||.||.|||||:||||:.|||||:||::|||
Mouse    14 KTFRPKRKFEPGTQRFELHKRAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRINLIYGT 78

  Fly    75 ITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVP 139
            |::.|||::|.:||.||||||.|.|....:||...|||:|:|.||.|::.|:::|.:||:.:|.|
Mouse    79 ISDGCTEQSCPVMSGGPKYEYRWQDEQRFRKPTALSAPRYMDLLMDWIEVQINNEDIFPTNVGTP 143

  Fly   140 FPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPL 204
            |||.|..:.:.||.|||||:.|:|..||..:..:|.|||:||.:|||.:||.|||||:.:||.||
Mouse   144 FPKTFLQAVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVTEFNLIDPKELEPL 208

  Fly   205 QELIDKL 211
            :|:..::
Mouse   209 KEMTSRM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 92/170 (54%)
Mob3aNP_766045.2 Mob1_phocein 36..208 CDD:281617 92/171 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54186
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R729
SonicParanoid 1 1.000 - - X263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.