DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob-2

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_510184.1 Gene:mob-2 / 181441 WormBaseID:WBGene00008601 Length:350 Species:Caenorhabditis elegans


Alignment Length:184 Identity:51/184 - (27%)
Similarity:82/184 - (44%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NAVA----LPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMS------------AGP 91
            |.||    ||:|.:..||:|.|.:..|..:|.|.||::|.||:::|..||            .|.
 Worm   126 NTVAKITSLPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTDERGK 190

  Fly    92 KYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLF 156
            :..|              .|.:|||.::|..:.....|.:||:|.|..|..||..:.|.:|..||
 Worm   191 RQVY--------------PAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLF 241

  Fly   157 RVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDK 210
            ....|:|.:|:..:..|.........|.|.....:.|:|::.::    ||.:|:
 Worm   242 HCMGHMYLKHWDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKD----QEQVDE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 48/176 (27%)
mob-2NP_510184.1 Mob1_phocein 120..287 CDD:281617 48/178 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.