DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob3c

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_002931452.1 Gene:mob3c / 100494365 XenbaseID:XB-GENE-975743 Length:216 Species:Xenopus tropicalis


Alignment Length:202 Identity:100/202 - (49%)
Similarity:149/202 - (73%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTFKPKKNIPEGTHQYDLMKHAAATLGSG-NLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGT 74
            |||:|:|....||.:::|.|.|.|:|.|| :|:..|.||.||::|:|:||:.|||||:||::|||
 Frog    13 KTFRPRKKFEPGTQRFELYKKAQASLKSGLDLKTVVQLPPGENINDWIAVHVVDFFNRINLIYGT 77

  Fly    75 ITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVP 139
            ::|||||.:|.||..|.||||.|.|....|:|.|.|||.|::.||.|::..:::|.:||:::|||
 Frog    78 MSEFCTERSCPIMCGGLKYEYRWQDDNKYKRPTKVSAPLYMNMLMEWIETLINNEDIFPTRMGVP 142

  Fly   140 FPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPL 204
            |||||......||.|||||:.|:|..||..::::|.|||:||.:|||.:|:.||:|::.|||.||
 Frog   143 FPKNFQQVCNKILTRLFRVFVHVYIHHFDAIISVGAEAHVNTCYKHFYYFITEFSLVDHRELEPL 207

  Fly   205 QELIDKL 211
            :|:.:::
 Frog   208 KEMTERI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 87/170 (51%)
mob3cXP_002931452.1 Mob1_phocein 35..207 CDD:367587 87/171 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54186
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R729
SonicParanoid 1 1.000 - - X263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.