DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mats and mob1a

DIOPT Version :9

Sequence 1:NP_001262835.1 Gene:mats / 42634 FlyBaseID:FBgn0038965 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_021331635.1 Gene:mob1a / 100005014 ZFINID:ZDB-GENE-030131-6506 Length:241 Species:Danio rerio


Alignment Length:240 Identity:185/240 - (77%)
Similarity:199/240 - (82%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFF 65
            |.||||:|||||||||||||||:|||:|:|||.|||||||||.||.||:|||||||:||||||||
Zfish     1 MSFLFGNRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRAAVMLPEGEDLNEWIAVNTVDFF 65

  Fly    66 NQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDET 130
            ||||||||||||||||..|.:|||||:||||||||..:|||||||||||||||||||||||||||
Zfish    66 NQINMLYGTITEFCTEVKCSVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET 130

  Fly   131 LFPSKI-------------------------GVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEV 170
            ||||||                         ||||||||.|.||||||||||||||||||||..|
Zfish   131 LFPSKIGLYGYIGYEHRGAVKPFHTIFLLVPGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAV 195

  Fly   171 VTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKD 215
            :.|.||||||||||||||||||||||:||||||||:||:||.:||
Zfish   196 IQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQDLIEKLGSKD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
matsNP_001262835.1 Mob1_phocein 34..204 CDD:397617 149/194 (77%)
mob1aXP_021331635.1 Mob1_phocein 33..229 CDD:308952 149/195 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580620
Domainoid 1 1.000 325 1.000 Domainoid score I1167
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 402 1.000 Inparanoid score I1882
OMA 1 1.010 - - QHG54186
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0000364
OrthoInspector 1 1.000 - - otm25912
orthoMCL 1 0.900 - - OOG6_101569
Panther 1 1.100 - - LDO PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.