DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqfR and AT3G23350

DIOPT Version :9

Sequence 1:NP_732736.2 Gene:lqfR / 42632 FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:NP_001325534.1 Gene:AT3G23350 / 821916 AraportID:AT3G23350 Length:282 Species:Arabidopsis thaliana


Alignment Length:143 Identity:43/143 - (30%)
Similarity:74/143 - (51%) Gaps:8/143 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNK--TNWRRT 83
            |:.:.||.|..|.|.||.||..|....|.::|.::|....:..::.:|.:::.:|.:  .|||..
plant    28 VLTDVTEAELLVEEVTNGDPSSPDAKTMTKIAEASFDTVEYWRIVDVLHRKIGKDEREIKNWREA 92

  Fly    84 YKSLLLLNYLVRNGSERVVTSSREHIYDL---RSLENYTFTDEGGKDQGINVRHKVRELIDFIQD 145
            ||:::||.:|:.:|.   :....:.:|||   |.|..:.:.|..|.|.|..|:.|..::...:..
plant    93 YKAMVLLEFLLMHGP---IHLPHDFLYDLDHFRFLSTFQYVDNNGFDWGAQVQKKADQIQTLLLG 154

  Fly   146 DDRLREERKKAKK 158
            .:.|||.|.||.|
plant   155 KEELREARLKALK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627 34/127 (27%)
DUF4045 <226..459 CDD:289995
Telomere_reg-2 1072..1184 CDD:287202
AT3G23350NP_001325534.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.