DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13850 and FASTKD3

DIOPT Version :9

Sequence 1:NP_001262834.1 Gene:CG13850 / 42630 FlyBaseID:FBgn0038961 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_076996.2 Gene:FASTKD3 / 79072 HGNCID:28758 Length:662 Species:Homo sapiens


Alignment Length:289 Identity:67/289 - (23%)
Similarity:109/289 - (37%) Gaps:56/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 ILESLTQWLLKNSEICRPQDLSAYFLTSALLNFKSAQLEEVSKKLVKSIVRE-DFTKQSEWLSFV 361
            ||.::.:..:..:|...|:.:||.......||:.......:.:||...:... ::......|..:
Human   388 ILNAVAETFVCQTEKFSPRQISALMEPFGKLNYLPPNASALFRKLENVLFTHFNYFPPKSLLKLL 452

  Fly   362 WSLTMLGLVEHGHLASVLSADFLETLKKDKAGVTATSKMRLLNLNSYAQLIATDYKGPLLPTDSP 426
            .|.::........||.:....||:.|:..::.:...|:.:|..|...:.|....||||.|   .|
Human   453 HSCSLNECHPVNFLAKIFKPLFLQRLQGKESHLDTLSRAQLTQLFLASVLECPFYKGPKL---LP 514

  Fly   427 VYQVPMAHPKAKQVLVNGMLDALKSLLPASNHLQTAVDT------KMGF--LIDALCHFDANKNP 483
            .|||                   ||.|.....|:|.||:      |:|.  |:.|..:| |.|..
Human   515 KYQV-------------------KSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYF-APKVL 559

  Fly   484 LP----------LDKEN---PNAI------RVALMVIDFHDIC-HGTHRSG-SGVTNLTFDLLEK 527
            .|          ||:|.   |:..      |:||.:......| :..|..| ..:......||  
Human   560 TPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLL-- 622

  Fly   528 SGYHVIPVPYNEFSTSDKLLKRVQYLESK 556
             ||.|:.:||:|........:.|:||:.|
Human   623 -GYQVVQIPYHEIGMLKSRRELVEYLQRK 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13850NP_001262834.1 FAST_1 319..385 CDD:284217 11/66 (17%)
FAST_2 402..484 CDD:285557 26/89 (29%)
RAP 498..556 CDD:214932 15/59 (25%)
FASTKD3NP_076996.2 FAST_1 409..477 CDD:284217 12/67 (18%)
FAST_2 493..579 CDD:285557 30/108 (28%)
RAP 593..650 CDD:214932 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M88
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41943
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.