DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13850 and Fastk

DIOPT Version :9

Sequence 1:NP_001262834.1 Gene:CG13850 / 42630 FlyBaseID:FBgn0038961 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_075718.2 Gene:Fastk / 66587 MGIID:1913837 Length:545 Species:Mus musculus


Alignment Length:444 Identity:89/444 - (20%)
Similarity:160/444 - (36%) Gaps:104/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 PQMVKVMSTLAQRKRRSTPL----LRSLAFNISSASESLDLKQAGDVLFAMSTLNFQDSVLGAKV 263
            |..::.:..|...:.|.:|:    |:.|:..|.....|.|:......|.....|.|...  |..:
Mouse   111 PVALRRLGQLLVSQPRPSPVEQATLQDLSQLIIRNCPSFDVHTIHVCLHLAVLLGFPSD--GPLL 173

  Fly   264 CA---DVQSAL---PKNVEKSAVVGS--IITSLGILRYRDLDILESLTQWLLKNSEICRPQDLSA 320
            ||   :.:|.|   |.:..:.|:.|.  :..:|...|:     |:...|.|:::....||::|:.
Mouse   174 CALEQERRSRLPPKPPSPHRPAIYGGQRLEVALSCPRF-----LQYPRQHLIRSLAEARPEELTP 233

  Fly   321 YF-----------------LTSALLNFKSAQLEEVSKKLVKSIV--------------------- 347
            :.                 |..|:.:|...|..:::.|:|:.:|                     
Mouse   234 HVMVLLAQHLARHRLREPQLLEAIAHFLVVQEAQLNSKVVQKLVLPFGRLNYMPLEQQFMPCLER 298

  Fly   348 ---REDFTKQSEWLSFVWSLTMLGLVEHGHLASVLSADFLETLKKDKAGVTATSKMRLLNLNSYA 409
               ||........::.:.||..|..:....|..|.|..|:..:......:.....:.|  |::..
Mouse   299 ILAREAGVAPLATVNILMSLCQLQCLPFRALQFVFSPSFINHINGTPPSLIVRRYLSL--LDTAV 361

  Fly   410 QLIATDYKGPLLPTDS--PVYQVPMAHPKA------KQVLVNGMLDALKSLLPASNHLQTAVDTK 466
            :|....|:||.||...  |::..|:...:|      |.::..|    |:.||...|:.|. :...
Mouse   362 ELELPGYQGPRLPQRQRVPIFPQPLITDRARCKYSHKDMVAEG----LRQLLGEENYRQN-LTVP 421

  Fly   467 MGFLIDALCHFDANKNPLPLDKENP----------------------NAIRVALMVIDFHDICHG 509
            .|:..|.|....::...||:..::|                      .|.||.||:.:....|  
Mouse   422 PGYCTDFLLCVSSSGAVLPMRTQDPFLPYPPRSCQQDQANFNSTTQDPAQRVVLMLRERWHFC-- 484

  Fly   510 THRSGS---GVTNLTFDLLEKSGYHVIPVPYNEFSTSDKLLKRVQYLESKFKAI 560
              |.|.   |...|....|...||.::|:|:.|..:...|.:...||..|.:|:
Mouse   485 --RDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13850NP_001262834.1 FAST_1 319..385 CDD:284217 16/106 (15%)
FAST_2 402..484 CDD:285557 21/89 (24%)
RAP 498..556 CDD:214932 16/60 (27%)
FastkNP_075718.2 FAST_1 274..339 CDD:284217 10/64 (16%)
FAST_2 354..439 CDD:285557 21/91 (23%)
RAP 480..532 CDD:214932 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M88
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.