DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13850 and FASTK

DIOPT Version :9

Sequence 1:NP_001262834.1 Gene:CG13850 / 42630 FlyBaseID:FBgn0038961 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_006703.1 Gene:FASTK / 10922 HGNCID:24676 Length:549 Species:Homo sapiens


Alignment Length:344 Identity:68/344 - (19%)
Similarity:120/344 - (34%) Gaps:93/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LRYRDLDILESLTQWLLKNSEICRPQDLSAYF-----------------LTSALLNFKSAQLEEV 338
            |||....::.||.:        .||::|:.:.                 |..|:.:|...|..::
Human   216 LRYPRQHLISSLAE--------ARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQL 272

  Fly   339 SKKLVKSIV------------------------REDFTKQSEWLSFVWSLTMLGLVEHGHLASVL 379
            |.|:|:.:|                        ||........::.:.||..|..:....|..|.
Human   273 SSKVVQKLVLPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVF 337

  Fly   380 SADFLETLKKDKAGVTATSKMRLLNLNSYAQLIATDYKGPLLP--TDSPVYQVPMAHPKA----- 437
            |..|:..:......:.....:.|  |::..:|....|:||.||  ...|::..|:...:|     
Human   338 SPGFINYISGTPHALIVRRYLSL--LDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYS 400

  Fly   438 -KQVLVNGMLDALKSLLPASNHLQTAVDTKMGFLIDALCHFDANKNPLPLDKENP---------- 491
             |.::..|    |:.||....:.|. :....|:..|.|....::...||:..::|          
Human   401 HKDIVAEG----LRQLLGEEKYRQD-LTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCP 460

  Fly   492 ------------NAIRVALMVIDFHDICHGTHRSGS---GVTNLTFDLLEKSGYHVIPVPYNEFS 541
                        .|.||.|::.:....|    |.|.   |...|....|...||.::|:|:.|..
Human   461 QGQAASSATTRDPAQRVVLVLRERWHFC----RDGRVLLGSRALRERHLGLMGYQLLPLPFEELE 521

  Fly   542 TSDKLLKRVQYLESKFKAI 560
            :...|.:...||..|.:|:
Human   522 SQRGLPQLKSYLRQKLQAL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13850NP_001262834.1 FAST_1 319..385 CDD:284217 17/106 (16%)
FAST_2 402..484 CDD:285557 20/89 (22%)
RAP 498..556 CDD:214932 15/60 (25%)
FASTKNP_006703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
FAST_1 278..343 CDD:310980 10/64 (16%)
FAST_2 358..443 CDD:312018 20/91 (22%)
RAP 484..536 CDD:214932 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M88
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.