DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7059 and AT5G22620

DIOPT Version :10

Sequence 1:NP_651034.2 Gene:CG7059 / 42626 FlyBaseID:FBgn0038957 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_197654.1 Gene:AT5G22620 / 832325 AraportID:AT5G22620 Length:482 Species:Arabidopsis thaliana


Alignment Length:231 Identity:59/231 - (25%)
Similarity:99/231 - (42%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QFMTK-TNRLVILRHGESDFNIENKFCGWHD-APLSEFGVQEALTVAIPALVQSELEFDVVYSSV 75
            ||..: |.|:|::|||:|.:|.|.:..|..| :.|::.|..:| .::...|:..  .|||.::|.
plant    41 QFTVETTKRVVLVRHGQSTWNEEGRIQGSSDFSVLTKKGESQA-EISRQMLIDD--SFDVCFTSP 102

  Fly    76 LSRSRQTAELILSKLNCAYVPIKEDWRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPP 140
            |.||::|||:|........:   .|:.|.|....:..|..|:...:::||...| |:.      .
plant   103 LKRSKKTAEIIWGSRESEMI---FDYDLREIDLYSFQGLLKKEGKEKFGEAFKQ-WQE------D 157

  Fly   141 PIDEKNRYFYTICSNPIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCVHGTVA 205
            |            :|.|.|    |.:|:.|    ...|.:..|..:.  ..:...||:..|..|.
plant   158 P------------ANFIID----GHYPVRE----LWSRARSCWPGIL--AHESKSVLVVAHNAVN 200

  Fly   206 RALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGG 241
            :||:....|:..|....:...||...|.:|..:..|
plant   201 QALLATAIGLGTEYFRSLLQSNCGVSVLDFIPRADG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7059NP_651034.2 GpmA 20..236 CDD:440353 54/216 (25%)
AT5G22620NP_197654.1 PhoE 47..241 CDD:440175 57/225 (25%)
His_Phos_1 268..468 CDD:459751
PRK07238 <382..472 CDD:180903
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.