DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and trmH

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_418108.1 Gene:trmH / 948161 ECOCYCID:EG10967 Length:229 Species:Escherichia coli


Alignment Length:162 Identity:41/162 - (25%)
Similarity:76/162 - (46%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   980 ARDDHELIVVASLIDKLPNLGGLARTCEVLGVNTLIL-----GLKSQAEKSDFTNLSMTAEKTLN 1039
            ||...:|.|....:.|..|:..:.||.:.:||:.:..     .:::.|..:..:| |....||..
E. coli    14 ARRQPDLTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTMASAAAGSN-SWVQVKTHR 77

  Fly  1040 ILEVNPESLAGFLLEKQMEGYKIVGAEQTAHSTNFVDFKFPKKSILLLGHEKHGIPANLIGFLDY 1104
            .:......|.|       :|.:|:....:.::.:|.:..:.:.:.:|:|.||.||....:...|.
E. coli    78 TIGDAVAHLKG-------QGMQILATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEALALADQ 135

  Fly  1105 AVEIPQYGLVRSLNVHVAGSLFIWEYCKQHLN 1136
            .:.||..|:|:||||.||.:|.::|..:|..|
E. coli   136 DIIIPMIGMVQSLNVSVASALILYEAQRQRQN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 36/146 (25%)
trmHNP_418108.1 PRK11081 1..228 CDD:236837 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I697
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002756
OrthoInspector 1 1.000 - - oto111906
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
65.810

Return to query results.
Submit another query.