DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and yfiF

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_417076.1 Gene:yfiF / 947066 ECOCYCID:EG11786 Length:345 Species:Escherichia coli


Alignment Length:144 Identity:40/144 - (27%)
Similarity:66/144 - (45%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   998 NLGGLARTCEVLGVNTLILG----LKSQAEKSDFTNLSMTAE-KTLNILEVNPESLAGFLLEKQM 1057
            ||||:.|:|...||..:::.    |:|.|       ...||| ...::..:..:::...|.:.:.
E. coli   210 NLGGMMRSCAHFGVKGVVVQDAALLESGA-------AIRTAEGGAEHVQPITGDNIVNVLDDFRQ 267

  Fly  1058 EGYKIVGAEQTAHSTNFVDFK--FPKKSILLLGHEKHGIPANLIGFLDYAVEIPQYGLVRSLNVH 1120
            .||.:|   .|:.......||  .|.|.:|:||.|..|:|.......|..|:|...|.|..||:.
E. coli   268 AGYTVV---TTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARDPNDLRVKIDGTGNVAGLNIS 329

  Fly  1121 VAGSLFIWEYCKQH 1134
            ||..:.:.|:.:|:
E. coli   330 VATGVLLGEWWRQN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 38/136 (28%)
yfiFNP_417076.1 PRK10864 1..345 CDD:236779 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002756
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.