DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and MRM1

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_079140.2 Gene:MRM1 / 79922 HGNCID:26202 Length:353 Species:Homo sapiens


Alignment Length:167 Identity:38/167 - (22%)
Similarity:77/167 - (46%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   982 DDHELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTNLSMTAEKTLNILEV-NP 1045
            |..:|.:|...|....|.|.:.|:...|||:.:|...::....:..  :|.::...:.:::| :.
Human   142 DPQQLWLVLDGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPV--VSKSSAGAMEVMDVFST 204

  Fly  1046 ESLAGFLLEKQMEGYKIVG-----AEQTAHSTNF-----VDFKFPKKSILLLGHEKHGIPANLIG 1100
            :.|.|||..|..:|:.:.|     :.:...|:..     ::|.:.:.::|:||:|..|:...:..
Human   205 DDLTGFLQTKAQQGWLVAGTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQA 269

  Fly  1101 FLDYAVEI-PQYGL---VRSLNVHVAGSLFIWEYCKQ 1133
            .....:.| |:..|   :.||||.||..:.:...|.|
Human   270 SCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 35/156 (22%)
MRM1NP_079140.2 SpoU 40..308 CDD:223640 38/167 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.