DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and mrm3b

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001157404.1 Gene:mrm3b / 792923 ZFINID:ZDB-GENE-030131-158 Length:449 Species:Danio rerio


Alignment Length:223 Identity:41/223 - (18%)
Similarity:85/223 - (38%) Gaps:55/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   897 PTSVSDCILMMTNAPFDENISFISCSYDFRMKLKRALE-------------TFKRKQSVLIPELA 948
            ||.:|:.::..|:....::.:.|:.:.|     |.::|             :...:|.|:.....
Zfish    47 PTEISEGVISQTSERSSQHNNDITRNTD-----KSSIENPVSPNNSQPVQFSHINRQKVINLTSR 106

  Fly   949 TSLAALNGNVQRKMNPVGDIYPESDFVVSNKARDDHELI-----VVASLIDKLPNLGGLARTCEV 1008
            |....::|.:..|::|......:...:..:|...:|:::     :|.|.:|    .|..|:|...
Zfish   107 TRFGEVDGLLYEKLHPGDKSLAKLARIAGSKKLREHQVVLEGKHLVCSALD----AGAEAQTLYF 167

  Fly  1009 LGVNTLILGLKSQAEKSDFTNLSMTAEKTLNILEVNPESLAGFLLEKQMEGYKIVGAEQTAHSTN 1073
            ..|:.|             ..|.:...:..|:::|            :||..::.....|:....
Zfish   168 SSVDAL-------------RELPLDKLRQTNVVKV------------KMEDAQVWSELDTSQEII 207

  Fly  1074 FVDFKFPKKSILLLGHEKHG--IPANLI 1099
            .: ||.|:.|.|....||:|  :|..||
Zfish   208 AI-FKRPEASRLTFSEEKYGRAVPLTLI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 25/121 (21%)
mrm3bNP_001157404.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..90 5/42 (12%)
SpoU 131..444 CDD:223640 27/134 (20%)
SpoU_sub_bind 146..211 CDD:214943 14/94 (15%)
SpoU_methylase 230..435 CDD:278985 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.