DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and Mrm3

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_899086.2 Gene:Mrm3 / 67390 MGIID:1914640 Length:418 Species:Mus musculus


Alignment Length:257 Identity:51/257 - (19%)
Similarity:84/257 - (32%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 LKRALETFKRKQSVLIPELATSLAALNGNVQRKMNPVGDIYPESDFVVSNKARDDHELIVVASLI 993
            :|...|..|....::.|:....:.|       |.:||...|||:..         |..:.:..:.
Mouse   166 IKVKFEDIKDWSDLVTPQGIMGIFA-------KPDPVKMTYPETPL---------HHTLPLVLIC 214

  Fly   994 DKL---PNLGGLARTCEVLGVNTLILGLKS--QAEKSDFTNLSMTAEKTLNIL-----EVNPESL 1048
            |.|   .|||.:.|:....|.:.::| .|.  .|.:.......|.|...:.|:     |..|..|
Mouse   215 DNLRDPGNLGTILRSAAGAGCSKVLL-TKGCVDAWEPKVLRAGMGAHFQVPIVNNVEWETVPNHL 278

  Fly  1049 -----------AGFLLEKQMEGYKIVGAEQTAHSTNFVDFK--------------FPKKSI---- 1084
                       .|...:.||...  .|....|....|:.|.              .||..:    
Mouse   279 PPDTRVYVADNCGHYAQVQMSDK--TGDRDWACDRRFLKFHKYEEDLDTKTRKDWLPKLEVQSYD 341

  Fly  1085 ---------LLLGHEKHGIPANLIGFLDYA----VEIPQYGLVRSLNVHVAGSLFIWEYCKQ 1133
                     :::|.|.||:....:...:..    :.||....|.|||..:|.|:.::|..:|
Mouse   342 LDWTGAPAAVVIGGETHGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 37/193 (19%)
Mrm3NP_899086.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..90
SpoU 117..407 CDD:223640 51/257 (20%)
SpoU_sub_bind 125..191 CDD:214943 5/31 (16%)
SpoU_methylase 209..398 CDD:278985 37/191 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.