Sequence 1: | NP_651031.1 | Gene: | CG18596 / 42622 | FlyBaseID: | FBgn0038953 | Length: | 1136 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_899086.2 | Gene: | Mrm3 / 67390 | MGIID: | 1914640 | Length: | 418 | Species: | Mus musculus |
Alignment Length: | 257 | Identity: | 51/257 - (19%) |
---|---|---|---|
Similarity: | 84/257 - (32%) | Gaps: | 71/257 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 929 LKRALETFKRKQSVLIPELATSLAALNGNVQRKMNPVGDIYPESDFVVSNKARDDHELIVVASLI 993
Fly 994 DKL---PNLGGLARTCEVLGVNTLILGLKS--QAEKSDFTNLSMTAEKTLNIL-----EVNPESL 1048
Fly 1049 -----------AGFLLEKQMEGYKIVGAEQTAHSTNFVDFK--------------FPKKSI---- 1084
Fly 1085 ---------LLLGHEKHGIPANLIGFLDYA----VEIPQYGLVRSLNVHVAGSLFIWEYCKQ 1133 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18596 | NP_651031.1 | SpoU_methylase | 986..1128 | CDD:278985 | 37/193 (19%) |
Mrm3 | NP_899086.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 41..90 | ||
SpoU | 117..407 | CDD:223640 | 51/257 (20%) | ||
SpoU_sub_bind | 125..191 | CDD:214943 | 5/31 (16%) | ||
SpoU_methylase | 209..398 | CDD:278985 | 37/191 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0566 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |