DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and mrm3a

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001017695.2 Gene:mrm3a / 550390 ZFINID:ZDB-GENE-050417-184 Length:434 Species:Danio rerio


Alignment Length:202 Identity:39/202 - (19%)
Similarity:66/202 - (32%) Gaps:70/202 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   951 LAALNGNVQRKMNPVGD-----------------------------IYPESDFVVSNKARDDHEL 986
            :|||..||.|.:..:|:                             :||:.          :.|.
Zfish     1 MAALMYNVSRGLVMLGERSLFQRERYQILVNSRRFLRGLRRRTVAVLYPDG----------ERET 55

  Fly   987 IVVASLIDKLPNLG----GLARTCEVLGVNTLILGLKSQAEKSDFTNLS-MTAEKTLNILEVNPE 1046
            ::.:..:..:.:.|    |.||              |...|::.:.|.| ..:|:.....::|..
Zfish    56 LIKSKRVTDITSQGFTQKGKAR--------------KDVTERAAYKNCSGYVSERAEESPQINKL 106

  Fly  1047 SLAGFLLEKQMEG-YKIVGAEQTAHSTNFVDFKFPKKSILLLGHE------KHGIPANLIGF--L 1102
            .|||...||...| .::......|.|..|.|   .:..:||.|..      ..|....:|.|  |
Zfish   107 KLAGLRFEKAPAGDNRLARVSSVARSRAFRD---KEGKVLLEGRRLICDALSAGASPQMIFFSLL 168

  Fly  1103 DYAVEIP 1109
            :...|:|
Zfish   169 ERLQELP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 29/138 (21%)
mrm3aNP_001017695.2 SpoU 129..421 CDD:223640 13/50 (26%)
SpoU_sub_bind 144..210 CDD:214943 8/32 (25%)
SpoU_methylase 228..412 CDD:278985
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.