DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and Mrm1

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001102302.1 Gene:Mrm1 / 363661 RGDID:1566232 Length:320 Species:Rattus norvegicus


Alignment Length:168 Identity:43/168 - (25%)
Similarity:79/168 - (47%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   982 DDHELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTNLSMTAEKTLNILEV--N 1044
            |..:|.:|...|....|||.:.|:...|||:.:|...::....:..  :|..:...:.:::|  :
  Rat   140 DPQQLWLVLEGIQDPRNLGAVMRSAYFLGVDRVITSRRNSCPLTPV--VSKASAGAMEVMDVFAS 202

  Fly  1045 PESLAGFLLEKQMEGYKIVGA------EQTAHS----TNFVDFKFPKKSILLLGHEKHGIPANLI 1099
            |: ||.||..|..:|:.:||.      |.:..|    |:.::|.:.:.::|:||:|..|:...:.
  Rat   203 PD-LASFLQAKAQQGWLVVGTVGCPGPEISQSSKVPVTSCLEFIWDRPTLLVLGNEGSGLSQGVF 266

  Fly  1100 GFLDYAVEI-PQYGL---VRSLNVHVAGSLFIWEYCKQ 1133
            ......:.| |...|   :.||||.||..:.:...|.|
  Rat   267 ATCQLLLTILPGRHLPPGLESLNVSVATGILLHSICSQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 40/157 (25%)
Mrm1NP_001102302.1 SpoU 38..301 CDD:223640 41/163 (25%)
SpoU_sub_bind 50..125 CDD:285300
SpoU_methylase 146..299 CDD:278985 39/155 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.