| Sequence 1: | NP_651030.1 | Gene: | CG7069 / 42621 | FlyBaseID: | FBgn0038952 | Length: | 744 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608713.2 | Gene: | CG2964 / 33475 | FlyBaseID: | FBgn0031462 | Length: | 554 | Species: | Drosophila melanogaster |
| Alignment Length: | 34 | Identity: | 9/34 - (26%) |
|---|---|---|---|
| Similarity: | 17/34 - (50%) | Gaps: | 6/34 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 312 LRSLQPDVRDIRFSVVADELDRVGKETLLRSLLE 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7069 | NP_651030.1 | Pyruvate_Kinase | 1..410 | CDD:453956 | 9/34 (26%) |
| PTZ00121 | <462..>741 | CDD:173412 | |||
| CG2964 | NP_608713.2 | Pyruvate_Kinase | 32..515 | CDD:453956 | 9/34 (26%) |
| Blue background indicates that the domain is not in the aligned region. | |||||