DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5382 and Zfpl1

DIOPT Version :9

Sequence 1:NP_732721.1 Gene:CG5382 / 42618 FlyBaseID:FBgn0038950 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001273865.1 Gene:Zfpl1 / 684755 RGDID:1586738 Length:310 Species:Rattus norvegicus


Alignment Length:327 Identity:139/327 - (42%)
Similarity:170/327 - (51%) Gaps:60/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTLEQGDC 65
            |||||||||.|||.|||||||||||||:|.:|.|||||||||||:||||..||.||.|.|...:.
  Rat     1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNTPLASRET 65

  Fly    66 VRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACSVEIFPNANLVSPVADALKSFLSQVNWGRN 130
            .|||||.:|||.|:|.|.|.||.||||.|:|||:|:..|||.|||..|||.||:..|:.|||.|.
  Rat    66 TRLVCYDLFHWACINERAAQLPRNTAPAGYQCPSCNGPIFPPANLAGPVASALREKLATVNWARA 130

  Fly   131 GLGLALLSEEQSSSLKAIKPKVASQAAVSN--MTKVHHIHSGGERERTKPNGHDAVSPHSVLLMD 193
            ||||.|:.|..|...:.:.....|..:..|  .|.|..     |||.|      |.:|  |....
  Rat   131 GLGLPLIDEVISPEPEPLNSSDFSDWSSFNATTTPVQE-----EREST------AAAP--VFYSQ 182

  Fly   194 AFNPPSAGDYASSRRPLLPRQSPI---GGT------------------------DRDDNKYQRRT 231
            ...||.:        |..|.|..:   |.|                        |.||:||:|| 
  Rat   183 VPRPPPS--------PSRPEQHTVIHMGSTEALTHAPRKVYDTRDDDRTAGVHGDCDDDKYRRR- 238

  Fly   232 PAELFSRWTRRFYAPSSRPP---WRRTWFLVTAGILAFVLFVYLMAWLGRGGSDAVDEGWNNPNP 293
            ||..:.....|..|.|.:.|   .:|...|:..|:|.|:..:.||:.|||..:|      ::||.
  Rat   239 PALGWLAQLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAAD------SDPNL 297

  Fly   294 QP 295
            .|
  Rat   298 DP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5382NP_732721.1 zf-RING_2 52..100 CDD:290367 28/47 (60%)
TctB <235..>277 CDD:284693 11/44 (25%)
Zfpl1NP_001273865.1 mRING-H2-C3DHC3_ZFPL1 50..104 CDD:319401 29/53 (55%)
modified RING-H2 finger (C3DHC3-type) 53..100 CDD:319401 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340779
Domainoid 1 1.000 220 1.000 Domainoid score I2531
eggNOG 1 0.900 - - E1_KOG3970
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4935
Inparanoid 1 1.050 221 1.000 Inparanoid score I3464
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489858at33208
OrthoFinder 1 1.000 - - FOG0006162
OrthoInspector 1 1.000 - - oto97572
orthoMCL 1 0.900 - - OOG6_105755
Panther 1 1.100 - - LDO PTHR12981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.