DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5382 and Y45G12B.2

DIOPT Version :9

Sequence 1:NP_732721.1 Gene:CG5382 / 42618 FlyBaseID:FBgn0038950 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_503731.1 Gene:Y45G12B.2 / 178734 WormBaseID:WBGene00021563 Length:309 Species:Caenorhabditis elegans


Alignment Length:310 Identity:118/310 - (38%)
Similarity:160/310 - (51%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTLEQGDC 65
            |||||||||.|||.||:||||||||.|:|.:||.|:|||||.||.|.||..||:||.|||.:||.
 Worm     1 MGLCKCPKRKVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLTWLTDQDYDPNCSLCKTTLAEGDT 65

  Fly    66 VRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACSVEIFPNANLVSPVADALKSFLSQVNWGRN 130
            :||.|.|:.||.|.:...|..||.|||.|::||.||.|:||..|.|||:.:.|:..|.|.||.|.
 Worm    66 IRLNCLHLLHWKCFDEWAANFPATTAPAGYRCPCCSQEVFPPINEVSPLIEKLREQLKQSNWARA 130

  Fly   131 GLGLALLSEEQSSSLKAIKPKVASQAAVSNMTKVHHIHSGGERERTKPNGH---DAVSPHSVLLM 192
            .|||..|.|..........|::.:...:.....||:..|      :.|..|   :..:.:||...
 Worm   131 ALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRS------STPATHLEMEDTASYSVSNN 189

  Fly   193 D---AFNPPSAGDYASSRRPLLPRQSPIGGTDRDDNKYQRRTPAELFSRWTRRFY--------AP 246
            |   |.......:.:|..||||    .:...|.::|||:||...:    |.|..:        .|
 Worm   190 DVTFARKKNYGAESSSDTRPLL----QLRDADNEENKYKRRPTMD----WMRGLWRAKHGGSGVP 246

  Fly   247 SSRPPWRR-TWFLVTAGILAFVLFVYLMAWLGRGG---SDAVDEGWNNPN 292
            ..|...:: ..|::...:||.:..:.:|...|..|   ||.:.:...|||
 Worm   247 QERASAKKIALFVIFLAVLALITIIMVMKRAGYSGEHSSDPLFDPMANPN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5382NP_732721.1 zf-RING_2 52..100 CDD:290367 25/47 (53%)
TctB <235..>277 CDD:284693 8/50 (16%)
Y45G12B.2NP_503731.1 zf-RING_2 51..100 CDD:290367 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159289
Domainoid 1 1.000 207 1.000 Domainoid score I1678
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4935
Inparanoid 1 1.050 208 1.000 Inparanoid score I2398
Isobase 1 0.950 - 0 Normalized mean entropy S3613
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489858at33208
OrthoFinder 1 1.000 - - FOG0006162
OrthoInspector 1 1.000 - - oto18006
orthoMCL 1 0.900 - - OOG6_105755
Panther 1 1.100 - - LDO PTHR12981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2961
SonicParanoid 1 1.000 - - X4450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.