DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and AT5G52980

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_200110.1 Gene:AT5G52980 / 835377 AraportID:AT5G52980 Length:222 Species:Arabidopsis thaliana


Alignment Length:142 Identity:27/142 - (19%)
Similarity:61/142 - (42%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 KPR--NPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPEDTISYQIKSLNKQIIAVVQFIFSV 217
            |||  :.||:.|..:||...:.::|.::.|::.      |:..:.....|...|:...:....::
plant    85 KPREKSEELKLRLVKLREIAERKEYAELVKDIT------PKKQVEEPFSSYKDQLGFGLHVGLTM 143

  Fly   218 AAGFTFGFFGVNLMVGPLPF-----GFRILLGVIVALIIALAEMYFLAKKLHEYDEVLDAPKRKP 277
            ..|:..|:.....:....|.     |   :||:::|:::  ..:.|:.|.  ..|:.:.:.|...
plant   144 FTGYLVGYASFRALFNRNPALSAAGG---ILGLVLAMLV--ETLLFIIKT--SKDDQIQSSKSFT 201

  Fly   278 QPSTPAKRTPPA 289
            |.|....::.|:
plant   202 QSSPSFTQSSPS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 22/119 (18%)
SalY <207..267 CDD:223650 9/64 (14%)
AT5G52980NP_200110.1 Vma12 73..193 CDD:371687 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105644
Panther 1 1.100 - - LDO PTHR31394
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.