DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and Tmem199

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_954669.2 Gene:Tmem199 / 195040 MGIID:2144113 Length:208 Species:Mus musculus


Alignment Length:208 Identity:59/208 - (28%)
Similarity:104/208 - (50%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GLEYKRPKLNYELLTKLTENLADKPEEPAKDKSEPDSGVKDSDDAKSTREVKHFLYLTDLHWLSK 123
            |.|.:|.:|..:|..:|...|..|           .:|   ||:|...|.:..|..:.|||    
Mouse    18 GGELEREQLPRKLRAQLEAALGKK-----------HAG---SDNATGPRRLVSFRLIRDLH---- 64

  Fly   124 TLAELRRQDHCQVFLHQLIESCDLLLPENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNV---D 185
               :..|:.:.:::||:|:|..|:..||....||||||.||.::::.:..|.:|.::|:||   |
Mouse    65 ---QHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQD 126

  Fly   186 AGLKHYPEDTISYQIKSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGFRILLGVIVALI 250
            |.......| :..|::|:...::.:..||.:|||.|...:.|...:...:  ..|:|..:|||.:
Mouse   127 AQCGGTLSD-LGKQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEM--ASRVLAALIVASV 188

  Fly   251 IALAEMYFLAKKL 263
            :.|||:|.:.:.:
Mouse   189 VGLAELYVMVRAM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 39/127 (31%)
SalY <207..267 CDD:223650 16/57 (28%)
Tmem199NP_954669.2 Angiomotin_C 9..>74 CDD:289044 18/76 (24%)
Vma12 78..202 CDD:288549 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849111
Domainoid 1 1.000 70 1.000 Domainoid score I9545
eggNOG 1 0.900 - - E1_29V96
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5160
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006873
OrthoInspector 1 1.000 - - oto93357
orthoMCL 1 0.900 - - OOG6_105644
Panther 1 1.100 - - LDO PTHR31394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.