DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and F09E5.11

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_495004.2 Gene:F09E5.11 / 184242 WormBaseID:WBGene00017289 Length:218 Species:Caenorhabditis elegans


Alignment Length:275 Identity:60/275 - (21%)
Similarity:108/275 - (39%) Gaps:92/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KKLLDFLDAQKKHLKELPENVAKIMKQRGHTLPTSIRIIKDAGLEYKRPKLNYELLTKLTENLAD 81
            |.||..|.|..|. |..|| |:|..|:                 .||:..::|:.|..:...|  
 Worm    11 KNLLRDLVAGSKE-KITPE-VSKSCKE-----------------FYKKDVVSYKDLVNIKTKL-- 54

  Fly    82 KPEEPAKDKSEPDSGVKDSDDAKSTREVKHFLYLTDLHWLSKTLAELRRQDHCQVFLHQLIESCD 146
                       ||.             :..|::...|        .|||:||.   .|..:    
 Worm    55 -----------PDG-------------IPVFVFFDRL--------TLRREDHT---YHASV---- 80

  Fly   147 LLLPENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPED---TISYQIKSLNKQII 208
                         |...:.:.||.:|:...|.::.::||...|:...|   ....:::::|:|:|
 Worm    81 -------------EFRKKTEELRIQQEQDSYKRLIRDVDPVQKYGKTDHMENFGVEMRAVNRQMI 132

  Fly   209 AVVQFIFSVAAGFTFGFFGV-------NLMVGPLPFGFRILLGVIVALIIALAEMYFLAKKLHEY 266
            :|:..:.:|...|.|||.|:       ||   .||  .|.:.|::.|.|:...::||:.|.:   
 Worm   133 SVINVVITVVGSFFFGFSGITYAYPHLNL---DLP--TRFIFGLVPATIVFFCDLYFVVKGM--- 189

  Fly   267 DEVLDAPKRKPQPST 281
             ::.::.:.:|:.||
 Worm   190 -DMGESSETQPREST 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 30/137 (22%)
SalY <207..267 CDD:223650 19/66 (29%)
F09E5.11NP_495004.2 Vma12 79..196 CDD:288549 30/142 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29V96
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006873
OrthoInspector 1 1.000 - - oto17946
orthoMCL 1 0.900 - - OOG6_105644
Panther 1 1.100 - - LDO PTHR31394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.