DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and TMEM199

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_689677.1 Gene:TMEM199 / 147007 HGNCID:18085 Length:208 Species:Homo sapiens


Alignment Length:195 Identity:55/195 - (28%)
Similarity:100/195 - (51%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KPEE-PAKDKSEPDSGV----KDSDDAKSTREVKHFLYLTDLHWLSKTLAELRRQDHCQVFLHQL 141
            :||. |.|.::|.::.:    |..|.:...:.:..|..:.|||      ..||.:| .:::||:|
Human    22 EPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLH------QHLRERD-SKLYLHEL 79

  Fly   142 IESCDLLLPENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPEDT--------ISY 198
            :|..::.|||....||||||.||.::::.:..|.:|.::|:||..      :||        :..
Human    80 LEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTC------QDTRHGGTLSDLGK 138

  Fly   199 QIKSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGFRILLGVIVALIIALAEMYFLAKKL 263
            |::||...:|.:..||.:|.|.|...:.|...:...:  ..|:|..:|||.::.|||:|.:.:.:
Human   139 QVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEM--ASRVLAALIVASVVGLAELYVMVRAM 201

  Fly   264  263
            Human   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 39/132 (30%)
SalY <207..267 CDD:223650 16/57 (28%)
TMEM199NP_689677.1 Vma12 78..202 CDD:314557 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158712
Domainoid 1 1.000 69 1.000 Domainoid score I9679
eggNOG 1 0.900 - - E1_29V96
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5202
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006873
OrthoInspector 1 1.000 - - oto89785
orthoMCL 1 0.900 - - OOG6_105644
Panther 1 1.100 - - LDO PTHR31394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.