DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and tmem199

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001120106.1 Gene:tmem199 / 100145125 XenbaseID:XB-GENE-5841561 Length:194 Species:Xenopus tropicalis


Alignment Length:198 Identity:60/198 - (30%)
Similarity:93/198 - (46%) Gaps:32/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EEPAKDK-----SEPDSGVKDSDDAKSTREVKH-------FLYLTDLHWLSKTLAELRRQDHCQV 136
            |..|.||     ||..:|.|..........:|.       |..|.:||       .:.||....|
 Frog     4 EYRAGDKLIKALSEEVTGFKTGSRMAVEEALKQGPGAVVPFAVLRELH-------GILRQKGSPV 61

  Fly   137 FLHQLIESCDLLLPENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDA-GLKHYPEDTISYQI 200
            :||:|:|..::.||..|:..|||||.||.::::|:..|.:|.|||:|:.. ..:|.....:|..:
 Frog    62 YLHELLEGSEIHLPAVEIPERNPELVARLEKIKAKLANEEYKKMTQNITGQANRHGTLSELSRSV 126

  Fly   201 KSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGF-----RILLGVIVALIIALAEMYFLA 260
            :.:.|.:|.|..|..:|||.|...:.|...:       |     |:|..||||.::.|||:|.|.
 Frog   127 QPVKKMVITVFNFFVTVAAAFACTYIGTQYI-------FTESTSRVLSSVIVASLVGLAELYVLV 184

  Fly   261 KKL 263
            :.:
 Frog   185 RTM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 42/130 (32%)
SalY <207..267 CDD:223650 20/62 (32%)
tmem199NP_001120106.1 Vma12 65..188 CDD:288549 42/130 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9105
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006873
OrthoInspector 1 1.000 - - oto103593
Panther 1 1.100 - - LDO PTHR31394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.