DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7071 and tmem199

DIOPT Version :9

Sequence 1:NP_001287463.1 Gene:CG7071 / 42617 FlyBaseID:FBgn0260467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001099067.1 Gene:tmem199 / 100001648 ZFINID:ZDB-GENE-050522-150 Length:195 Species:Danio rerio


Alignment Length:196 Identity:54/196 - (27%)
Similarity:101/196 - (51%) Gaps:25/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LADKPEEPAKDKSEPDSGVKDSDDAKSTREVKHFLYLTDLHWLSKTLAELRR--QDHCQ-VFLHQ 140
            :.::.:|..:|..|..|.:  |::.|  .|:|.|...:.:.:  ||:.:|.:  ||:.. |.||:
Zfish     7 IGERFKERLRDLLESKSAI--SEELK--EELKTFKDQSIIPF--KTVRKLHKLLQDNGHPVHLHE 65

  Fly   141 LIESCDLLLPENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPEDTISY------- 198
            |.|...|.|||....||||:|.||.::::|:..|.:|.::|:||:      |::...:       
Zfish    66 LFEDSTLHLPEVITPPRNPQLVARLEKIKAKLANEEYKRITRNVN------PQEMNQHGTLADFG 124

  Fly   199 -QIKSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGFRILLGVIVALIIALAEMYFLAKK 262
             |::|:...::.|..|:.:|.|.|...:.|...:.....  .|::..||.|.::.|||:|.|.:.
Zfish   125 RQVRSVKAVVVTVFNFLVTVIAAFACSYLGSQYIFTETT--ARVIAAVIAASVVGLAELYVLVRT 187

  Fly   263 L 263
            :
Zfish   188 M 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7071NP_001287463.1 Vma12 140..268 CDD:288549 37/132 (28%)
SalY <207..267 CDD:223650 15/57 (26%)
tmem199NP_001099067.1 Vma12 65..189 CDD:288549 37/132 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594671
Domainoid 1 1.000 65 1.000 Domainoid score I10066
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5293
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006873
OrthoInspector 1 1.000 - - oto39590
orthoMCL 1 0.900 - - OOG6_105644
Panther 1 1.100 - - LDO PTHR31394
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.